12 documents found, page 1 of 2

Recombinant expression and purification of the antimicrobial peptide Magainin-2

Magainin-2 (MAG2) is a polycationic antimicrobial peptide isolated from the skin of the African clawed frog Xenopus laevis. It has a wide spectrum of antimicrobial activities against Gram-positive and Gram-negative bacteria, fungi and induces osmotic lysis of protozoa. MAG2 also possesses antiviral and antitumoral properties. These activities make this peptide a promising candidate for therapeutic applications....

Bioactivity of the recombinant human antimicrobial peptide LL37 : a key role in...

LL37, a human antimicrobial peptide with immunomodulatory properties

Cationic antimicrobial peptides (AMPs) represent the first line of defense against many invading pathogens. These small amphipathic peptides are part of the innate immune system and have a broad-spectrum activity against bacteria, fungi and viruses. In mammals, at least two distinct groups of AMPs are found. Defensins are the more representatives and cathelicidins form the second group. The hCAP18/LL37 is the o...

Wound healing activity of the human antimicrobial peptide LL37

Antimicrobial peptides (AMPs) are part of the innate immune system and are generally defined as cationic, amphipathic peptides, with less than 50 amino acids, including multiple arginine and lysine residues. The human cathelicidin antimicrobial peptide LL37 can be found at different concentrations in many different cells, tissues and body fluids and has a broad spectrum of antimicrobial and immunomodulatory act...

Recombinant expression and activity of cationic antimicrobial peptides

In the past 60 years, antibiotics have been critical in the fight against infectious disease caused by microorganisms. The increasing bacterial resistance to antibiotics is a serious public health problem. Much research has been dedicated to the development of new classes of antibiotics to overcome this situation. Antimicrobial peptides (AMPs) are generally defined as peptides of less than 50 amino acid residue...

Escherichia coli expression and purification of LL37 fused to a family III carb...

The cathelicidin derived human peptide LL37 has a broad spectrum of antimicrobial and immunomodulatory activities. The large variety of biological activities makes LL37 a very promising candidate for clinical applications. The production of biologically active LL37 in large amounts with reduced costs can only be achieved using recombinant techniques. In this work, LL37 has been cloned to the N- and C-termini of...

Self assembling nanogels

Escherichia coli expression and purification of LL37 fused to a family III carb...

[Excerpt] Introduction: LL-37 ([LL-37, 37 aa]) is a very promising human cationic peptide with 37 aminoacids and α-helix structure. It has been shown to exhibit a broad spectrum of antimicrobial activity and to have additional defensive roles such as regulating the inflammatory response and chemo-attracting cells of the adaptative immune system to wound or infection sites, binding and neu...

New hydrogel obtained by chitosan and dextrin-VA co-polymerization

Textile depilling : superior finishing using cellulose-binding domains with res...

Textile fabric depilling is an important industrial application of cellulases. The depilling effect and achievement of desirable touch properties are among the applications sought by users. This process, although effective, is associated with significant tensile strength loss. The depilling mechanism is still a subject of controversy. In this work, we introduce a new perspective in understanding of the depillin...